SCOP 1.69: Domain d1t66c2: 1t66 C:113-219

Lineage for d1t66c2 (1t66 C:113-219)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d1t66c2: 1t66 C:113-219 [106546]
   Other proteins in same PDB: d1t66c1, d1t66d1, d1t66d2, d1t66h1, d1t66h2, d1t66l1

Details for d1t66c2

PDB Entry: 1t66, 2.3 Å

PDB Description: The structure of FAB with intermediate affinity for fluorescein.

SCOP Domain Sequences for d1t66c2:

Sequence; same for both SEQRES and ATOM records:

>d1t66c2 b.1.1.2 (C:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqn
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1t66c2:

• d1t66c2 is new in SCOP 1.69
  
• d1t66c2 appears in SCOP 1.71
  
• d1t66c2 appears in the current release, SCOPe 2.08