Class b: All beta proteins [48724] (177 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein) Pfam PF06171; DUF984 |
Protein Hypothetical protein EF3133 [110340] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry) Uniprot Q82ZD1 |
PDB Entry: 1t62 (more details), 3 Å
SCOPe Domain Sequences for d1t62a1:
Sequence, based on SEQRES records: (download)
>d1t62a1 b.122.1.4 (A:1001-1153) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]} mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh arffkeelapyqlqfypdmllvcqsfevvdlyt
>d1t62a1 b.122.1.4 (A:1001-1153) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]} mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk eelapyqlqfypdmllvcqsfevvdlyt
Timeline for d1t62a1: