SCOPe 2.04: Domain d1t62a_: 1t62 A:

Lineage for d1t62a_ (1t62 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein)
   Pfam PF06171; DUF984

6. Protein Hypothetical protein EF3133 [110340] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry)
   Uniprot Q82ZD1

8. Domain d1t62a_: 1t62 A: [106541]
   Structural genomics target

Details for d1t62a_

PDB Entry: 1t62, 3 Å

PDB Description: crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1t62a_:

Sequence, based on SEQRES records:

>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh

Sequence, based on observed residues (ATOM records):

>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk
eelapyqlqfypdmllvcqsfevvdlythhhhh

Timeline for d1t62a_:

• d1t62a_ first appeared in SCOP 1.69
  
• d1t62a_ appears in SCOPe 2.03
  
• d1t62a_ appears in SCOPe 2.05
  
• d1t62a_ appears in the current release, SCOPe 2.08, called d1t62a1