Lineage for d1t62a_ (1t62 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472865Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 472866Superfamily b.122.1: PUA domain-like [88697] (4 families) (S)
  5. 472935Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein)
    DUF984: Pfam 06171
  6. 472936Protein Hypothetical protein EF3133 [110340] (1 species)
  7. 472937Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry)
  8. 472938Domain d1t62a_: 1t62 A: [106541]

Details for d1t62a_

PDB Entry: 1t62 (more details), 3 Å

PDB Description: crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984

SCOP Domain Sequences for d1t62a_:

Sequence, based on SEQRES records: (download)

>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus faecalis}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus faecalis}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk
eelapyqlqfypdmllvcqsfevvdlythhhhh

SCOP Domain Coordinates for d1t62a_:

Click to download the PDB-style file with coordinates for d1t62a_.
(The format of our PDB-style files is described here.)

Timeline for d1t62a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t62b_