Lineage for d1t5xb2 (1t5x B:1-92)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406673Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1406713Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 1406720Domain d1t5xb2: 1t5x B:1-92 [106492]
    Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb1, d1t5xd1, d1t5xd2

Details for d1t5xb2

PDB Entry: 1t5x (more details), 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1t5xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5xb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1t5xb2:

Click to download the PDB-style file with coordinates for d1t5xb2.
(The format of our PDB-style files is described here.)

Timeline for d1t5xb2: