Lineage for d1t5xb1 (1t5x B:93-190)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933150Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 933158Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 933172Domain d1t5xb1: 1t5x B:93-190 [106491]
    Other proteins in same PDB: d1t5xa1, d1t5xa2, d1t5xb2, d1t5xd1, d1t5xd2

Details for d1t5xb1

PDB Entry: 1t5x (more details), 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1t5xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5xb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1t5xb1:

Click to download the PDB-style file with coordinates for d1t5xb1.
(The format of our PDB-style files is described here.)

Timeline for d1t5xb1: