Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
Domain d1t5xa1: 1t5x A:82-181 [106489] Other proteins in same PDB: d1t5xa2, d1t5xb1, d1t5xb2, d1t5xd1, d1t5xd2 |
PDB Entry: 1t5x (more details), 2.5 Å
SCOPe Domain Sequences for d1t5xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5xa1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1t5xa1:
View in 3D Domains from other chains: (mouse over for more information) d1t5xb1, d1t5xb2, d1t5xd1, d1t5xd2 |