Lineage for d1t5wd2 (1t5w D:4-81)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600497Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 600507Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
  8. 600518Domain d1t5wd2: 1t5w D:4-81 [106486]
    Other proteins in same PDB: d1t5wa1, d1t5wb1, d1t5wb2, d1t5wd1, d1t5we1, d1t5we2

Details for d1t5wd2

PDB Entry: 1t5w (more details), 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)

SCOP Domain Sequences for d1t5wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5wd2 d.19.1.1 (D:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1t5wd2:

Click to download the PDB-style file with coordinates for d1t5wd2.
(The format of our PDB-style files is described here.)

Timeline for d1t5wd2: