SCOPe 2.05: Domain d1t47a1: 1t47 A:16-178

Lineage for d1t47a1 (1t47 A:16-178)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Streptomyces avermitilis [TaxId:33903] [110876] (1 PDB entry)
   Uniprot Q53586

8. Domain d1t47a1: 1t47 A:16-178 [106398]
   complexed with fe2, ntd

Details for d1t47a1

PDB Entry: 1t47, 2.5 Å

PDB Description: Structure of fe2-HPPD bound to NTBC

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1t47a1:

Sequence; same for both SEQRES and ATOM records:

>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]}
dpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsretasyvltngsarfvl
tsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaiehgarsvaepyelkdeh
gtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppa

Timeline for d1t47a1:

• d1t47a1 first appeared in SCOP 1.69
  
• d1t47a1 appears in SCOPe 2.04
  
• d1t47a1 appears in SCOPe 2.06
  
• d1t47a1 appears in the current release, SCOPe 2.08