SCOPe 2.04: Domain d1t3qa1: 1t3q A:88-168

Lineage for d1t3qa1 (1t3q A:88-168)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Quinoline 2-oxidoreductase small subunit QorS, C-domain [109849] (1 species)

7. Species Pseudomonas putida [TaxId:303] [109850] (1 PDB entry)
   Uniprot P72223

8. Domain d1t3qa1: 1t3q A:88-168 [106367]
   Other proteins in same PDB: d1t3qa2, d1t3qb1, d1t3qb2, d1t3qc1, d1t3qc2, d1t3qd2, d1t3qe1, d1t3qe2, d1t3qf1, d1t3qf2
   complexed with fad, fes, gol, mcn, smo, so4

Details for d1t3qa1

PDB Entry: 1t3q, 1.8 Å

PDB Description: crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86

PDB Compounds: (A:) quinoline 2-oxidoreductase small subunit

SCOPe Domain Sequences for d1t3qa1:

Sequence; same for both SEQRES and ATOM records:

>d1t3qa1 a.56.1.1 (A:88-168) Quinoline 2-oxidoreductase small subunit QorS, C-domain {Pseudomonas putida [TaxId: 303]}
qgeklnalqdsfrrhhalqcgfctagmlatarsilaenpapsrdevrevmsgnlcrctgy
etiidaitdpavaeaarrgev

Timeline for d1t3qa1:

• d1t3qa1 first appeared in SCOP 1.69
  
• d1t3qa1 appears in SCOPe 2.03
  
• d1t3qa1 appears in SCOPe 2.05
  
• d1t3qa1 appears in the current release, SCOPe 2.08