SCOP 1.69: Domain d1t3na1: 1t3n A:300-414

Lineage for d1t3na1 (1t3n A:300-414)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase iota [111015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111016] (1 PDB entry)

8. Domain d1t3na1: 1t3n A:300-414 [106363]
   Other proteins in same PDB: d1t3na2, d1t3nb2

Details for d1t3na1

PDB Entry: 1t3n, 2.3 Å

PDB Description: structure of the catalytic core of dna polymerase iota in complex with dna and dttp

SCOP Domain Sequences for d1t3na1:

Sequence; same for both SEQRES and ATOM records:

>d1t3na1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens)}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Timeline for d1t3na1:

• d1t3na1 is new in SCOP 1.69
  
• d1t3na1 appears in SCOP 1.71
  
• d1t3na1 appears in the current release, SCOPe 2.08