![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) ![]() |
![]() | Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
![]() | Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53160] (6 PDB entries) |
![]() | Domain d1t39b2: 1t39 B:7-91 [106338] Other proteins in same PDB: d1t39a1, d1t39b1 complexed with e1x |
PDB Entry: 1t39 (more details), 3.3 Å
SCOP Domain Sequences for d1t39b2:
Sequence, based on SEQRES records: (download)
>d1t39b2 c.55.7.1 (B:7-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)} mkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctawl nayfhqpeaieefpvpalhhpvfqq
>d1t39b2 c.55.7.1 (B:7-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)} mkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalhh pvfqq
Timeline for d1t39b2: