Lineage for d1t39b1 (1t39 B:92-174)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306333Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) (S)
    automatically mapped to Pfam PF01035
  5. 2306334Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)
  6. 2306338Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)
  7. 2306339Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
    Uniprot P16455 6-176
  8. 2306349Domain d1t39b1: 1t39 B:92-174 [106337]
    Other proteins in same PDB: d1t39a2, d1t39b2
    protein/DNA complex

Details for d1t39b1

PDB Entry: 1t39 (more details), 3.3 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
PDB Compounds: (B:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1t39b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t39b1 a.4.2.1 (B:92-174) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllahegh

SCOPe Domain Coordinates for d1t39b1:

Click to download the PDB-style file with coordinates for d1t39b1.
(The format of our PDB-style files is described here.)

Timeline for d1t39b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t39b2