Lineage for d1t39a2 (1t39 A:6-91)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495601Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) (S)
  5. 2495602Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 2495606Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 2495607Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
    Uniprot P16455 6-176
  8. 2495616Domain d1t39a2: 1t39 A:6-91 [106336]
    Other proteins in same PDB: d1t39a1, d1t39b1
    protein/DNA complex

Details for d1t39a2

PDB Entry: 1t39 (more details), 3.3 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna
PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1t39a2:

Sequence, based on SEQRES records: (download)

>d1t39a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records): (download)

>d1t39a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalh
hpvfqq

SCOPe Domain Coordinates for d1t39a2:

Click to download the PDB-style file with coordinates for d1t39a2.
(The format of our PDB-style files is described here.)

Timeline for d1t39a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t39a1