![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) ![]() automatically mapped to Pfam PF01035 |
![]() | Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) |
![]() | Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries) Uniprot P16455 6-176 |
![]() | Domain d1t39a1: 1t39 A:92-175 [106335] Other proteins in same PDB: d1t39a2, d1t39b2 protein/DNA complex |
PDB Entry: 1t39 (more details), 3.3 Å
SCOPe Domain Sequences for d1t39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t39a1 a.4.2.1 (A:92-175) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs sgavgnysgglavkewllaheghr
Timeline for d1t39a1: