Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) |
Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries) Uniprot P16455 6-176 |
Domain d1t38a2: 1t38 A:6-91 [106334] Other proteins in same PDB: d1t38a1 protein/DNA complex |
PDB Entry: 1t38 (more details), 3.2 Å
SCOPe Domain Sequences for d1t38a2:
Sequence, based on SEQRES records: (download)
>d1t38a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw lnayfhqpeaieefpvpalhhpvfqq
>d1t38a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} emkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalh hpvfqq
Timeline for d1t38a2: