SCOP 1.71: Domain d1t36g4: 1t36 G:556-676

Lineage for d1t36g4 (1t36 G:556-676)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (6 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)

8. Domain d1t36g4: 1t36 G:556-676 [106328]
   Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g2, d1t36g5, d1t36g6, d1t36h1, d1t36h2
   complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36g4

PDB Entry: 1t36, 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

SCOP Domain Sequences for d1t36g4:

Sequence; same for both SEQRES and ATOM records:

>d1t36g4 c.30.1.1 (G:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

Timeline for d1t36g4:

• d1t36g4 first appeared in SCOP 1.69
  
• d1t36g4 appears in SCOP 1.73
  
• d1t36g4 appears in the current release, SCOPe 2.08