Lineage for d1t36g2 (1t36 G:936-1073)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482161Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 482162Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 482163Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 482164Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 482165Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
  8. 482205Domain d1t36g2: 1t36 G:936-1073 [106326]
    Other proteins in same PDB: d1t36a1, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1, d1t36h2

Details for d1t36g2

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

SCOP Domain Sequences for d1t36g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36g2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1t36g2:

Click to download the PDB-style file with coordinates for d1t36g2.
(The format of our PDB-style files is described here.)

Timeline for d1t36g2: