SCOPe 2.08: Domain d1t36g2: 1t36 G:936-1073

Lineage for d1t36g2 (1t36 G:936-1073)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)

6. Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)

7. Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
   Uniprot P00968

8. Domain d1t36g2: 1t36 G:936-1073 [106326]
   Other proteins in same PDB: d1t36a1, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g1, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1, d1t36h2
   complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36g2

PDB Entry: 1t36, 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

PDB Compounds: (G:) Carbamoyl-phosphate synthase large chain

SCOPe Domain Sequences for d1t36g2:

Sequence; same for both SEQRES and ATOM records:

>d1t36g2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

Timeline for d1t36g2:

• d1t36g2 first appeared in SCOP 1.69
  
• d1t36g2 appears in SCOPe 2.07