Lineage for d1t2ta_ (1t2t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009712Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily)
    beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix
  4. 3009713Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family) (S)
  5. 3009714Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins)
  6. 3009715Protein DNA-binding domain of intron endonuclease I-TevI [64498] (1 species)
    contains extra N-terminal zinc-finger domain
  7. 3009716Species Bacteriophage T4 [TaxId:10665] [64499] (2 PDB entries)
    Uniprot P13299 149-244
  8. 3009718Domain d1t2ta_: 1t2t A: [106288]
    protein/DNA complex; complexed with zn

Details for d1t2ta_

PDB Entry: 1t2t (more details), 2.5 Å

PDB Description: Crystal structure of the DNA-binding domain of intron endonuclease I-TevI with operator site
PDB Compounds: (A:) intron-associated endonuclease 1

SCOPe Domain Sequences for d1t2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ta_ d.285.1.1 (A:) DNA-binding domain of intron endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]}
kfckcgvriqtsaytcskcrnrsgennsffnhkhsditkskisekmkgkkpsnikkiscd
gvifdcaadaarhfkissglvtyrvksdkwnwfyin

SCOPe Domain Coordinates for d1t2ta_:

Click to download the PDB-style file with coordinates for d1t2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1t2ta_: