Lineage for d1t1sa2 (1t1s A:1-125)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828623Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 1828624Species Escherichia coli [TaxId:562] [69411] (11 PDB entries)
    Uniprot P45568
  8. 1828636Domain d1t1sa2: 1t1s A:1-125 [106271]
    Other proteins in same PDB: d1t1sa1, d1t1sa4, d1t1sb1, d1t1sb4
    complexed with cbq, mg, so4

Details for d1t1sa2

PDB Entry: 1t1s (more details), 2.4 Å

PDB Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate
PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1t1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1sa2 c.2.1.3 (A:1-125) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
kqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddeas
akllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagktil
lanke

SCOPe Domain Coordinates for d1t1sa2:

Click to download the PDB-style file with coordinates for d1t1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1t1sa2: