Lineage for d1t1ha1 (1t1h A:249-321)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264130Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 2264131Protein E3 ubiquitin ligase PUB14 [111461] (1 species)
    Armadillo repeat containing protein
  7. 2264132Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111462] (1 PDB entry)
    Uniprot Q8VZ40 249-321
  8. 2264133Domain d1t1ha1: 1t1h A:249-321 [106247]
    Other proteins in same PDB: d1t1ha2

Details for d1t1ha1

PDB Entry: 1t1h (more details)

PDB Description: nmr solution structure of the u box domain from atpub14, an armadillo repeat containing protein from arabidopsis thaliana
PDB Compounds: (A:) armadillo repeat containing protein

SCOPe Domain Sequences for d1t1ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1ha1 g.44.1.2 (A:249-321) E3 ubiquitin ligase PUB14 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
peyfrcpislelmkdpvivstgqtyerssiqkwldaghktcpksqetllhagltpnyvlk
slialwcesngie

SCOPe Domain Coordinates for d1t1ha1:

Click to download the PDB-style file with coordinates for d1t1ha1.
(The format of our PDB-style files is described here.)

Timeline for d1t1ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t1ha2