Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
Protein E3 ubiquitin ligase PUB14 [111461] (1 species) Armadillo repeat containing protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111462] (1 PDB entry) Uniprot Q8VZ40 249-321 |
Domain d1t1ha1: 1t1h A:249-321 [106247] Other proteins in same PDB: d1t1ha2 |
PDB Entry: 1t1h (more details)
SCOPe Domain Sequences for d1t1ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1ha1 g.44.1.2 (A:249-321) E3 ubiquitin ligase PUB14 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} peyfrcpislelmkdpvivstgqtyerssiqkwldaghktcpksqetllhagltpnyvlk slialwcesngie
Timeline for d1t1ha1: