Lineage for d1t0sc_ (1t0s C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1895171Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1895172Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 1895173Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 1895186Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries)
    Uniprot O87799
  8. 1895191Domain d1t0sc_: 1t0s C: [106228]
    Other proteins in same PDB: d1t0sa_, d1t0sb_
    complexed with bml, fe, mcr, oh

Details for d1t0sc_

PDB Entry: 1t0s (more details), 2.2 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase with 4-bromophenol bound
PDB Compounds: (C:) touB

SCOPe Domain Sequences for d1t0sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0sc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOPe Domain Coordinates for d1t0sc_:

Click to download the PDB-style file with coordinates for d1t0sc_.
(The format of our PDB-style files is described here.)

Timeline for d1t0sc_: