Lineage for d1t0sb_ (1t0s B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703588Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 2703601Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
    Uniprot O87802
  8. 2703604Domain d1t0sb_: 1t0s B: [106227]
    Other proteins in same PDB: d1t0sa_, d1t0sc_
    complexed with bml, fe, mcr, oh

Details for d1t0sb_

PDB Entry: 1t0s (more details), 2.2 Å

PDB Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase with 4-bromophenol bound
PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d1t0sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0sb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

SCOPe Domain Coordinates for d1t0sb_:

Click to download the PDB-style file with coordinates for d1t0sb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0sb_: