| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like (Pfam 06234) [110814] (1 family) ![]() possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
| Family d.15.12.1: TmoB-like (Pfam 06234) [110815] (1 protein) |
| Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species) |
| Species Pseudomonas stutzeri [TaxId:316] [110817] (3 PDB entries) |
| Domain d1t0rc_: 1t0r C: [106225] Other proteins in same PDB: d1t0ra_, d1t0rb_ |
PDB Entry: 1t0r (more details), 2.3 Å
SCOP Domain Sequences for d1t0rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0rc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri}
atfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtl
fprgmivsdaglrptetldiifmd
Timeline for d1t0rc_: