SCOPe 2.06: Domain d1t0ja_: 1t0j A:

Lineage for d1t0ja_ (1t0j A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein SH3-like domain of the L-type calcium channel [110158] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries)
   Uniprot P54287 38-362

8. Domain d1t0ja_: 1t0j A: [106211]
   Other proteins in same PDB: d1t0jb_, d1t0jc_
   complexed with cl

Details for d1t0ja_

PDB Entry: 1t0j, 2 Å

PDB Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit

PDB Compounds: (A:) voltage-gated calcium channel subunit beta2a

SCOPe Domain Sequences for d1t0ja_:

Sequence; same for both SEQRES and ATOM records:

>d1t0ja_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
ndwwigrlvkegceigfipspvklenmrlqheqrak

Timeline for d1t0ja_:

• d1t0ja_ first appeared in SCOP 1.69
  
• d1t0ja_ appears in SCOPe 2.05
  
• d1t0ja_ appears in SCOPe 2.07
  
• d1t0ja_ appears in the current release, SCOPe 2.08