Class b: All beta proteins [48724] (180 folds) |
Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) automatically mapped to Pfam PF00431 |
Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins) |
Protein Mannose-binding protein associated serine protease 2, MASP2 [89256] (2 species) duplication: contains two CUB domains separated by an EGF-like domain |
Species Human (Homo sapiens) [TaxId:9606] [110137] (2 PDB entries) Uniprot O00187 17-181 |
Domain d1szbb1: 1szb B:3-123 [106147] Other proteins in same PDB: d1szba2, d1szbb2 complexed with ca |
PDB Entry: 1szb (more details), 2.5 Å
SCOPe Domain Sequences for d1szbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szbb1 b.23.1.1 (B:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} lgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydfv klssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaae d
Timeline for d1szbb1: