SCOPe 2.06: Domain d1szba2: 1szb A:124-168

Lineage for d1szba2 (1szb A:124-168)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (2 species)
   EGF-like domain separates two CUB domains

7. Species Human (Homo sapiens) [TaxId:9606] [111402] (1 PDB entry)
   Uniprot O00187 17-181

8. Domain d1szba2: 1szb A:124-168 [106146]
   Other proteins in same PDB: d1szba1, d1szbb1
   complexed with ca

Details for d1szba2

PDB Entry: 1szb, 2.5 Å

PDB Description: Crystal structure of the human MBL-associated protein 19 (MAp19)

PDB Compounds: (A:) mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa)

SCOPe Domain Sequences for d1szba2:

Sequence; same for both SEQRES and ATOM records:

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}
idecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq

Timeline for d1szba2:

• d1szba2 first appeared in SCOP 1.69
  
• d1szba2 appears in SCOPe 2.05
  
• d1szba2 appears in SCOPe 2.07
  
• d1szba2 appears in the current release, SCOPe 2.08