Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Mannose-binding protein associated serine protease 2, MASP2 [90141] (2 species) EGF-like domain separates two CUB domains |
Species Human (Homo sapiens) [TaxId:9606] [111402] (1 PDB entry) Uniprot O00187 17-181 |
Domain d1szba2: 1szb A:124-168 [106146] Other proteins in same PDB: d1szba1, d1szbb1 complexed with ca |
PDB Entry: 1szb (more details), 2.5 Å
SCOPe Domain Sequences for d1szba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} idecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq
Timeline for d1szba2: