Lineage for d1syya_ (1syy A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441523Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 441534Species Chlamydia trachomatis [109786] (1 PDB entry)
  8. 441535Domain d1syya_: 1syy A: [106126]

Details for d1syya_

PDB Entry: 1syy (more details), 1.7 Å

PDB Description: crystal structure of the r2 subunit of ribonucleotide reductase from chlamydia trachomatis

SCOP Domain Sequences for d1syya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis}
qadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgkd
ielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafeea
vhthtflyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqef
vknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidlingi
keenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrle
riglkpiyhtknpfpwm

SCOP Domain Coordinates for d1syya_:

Click to download the PDB-style file with coordinates for d1syya_.
(The format of our PDB-style files is described here.)

Timeline for d1syya_: