SCOP 1.73: Domain d1sy6l2: 1sy6 L:107-213

Lineage for d1sy6l2 (1sy6 L:107-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1sy6l2: 1sy6 L:107-213 [106116]
   Other proteins in same PDB: d1sy6a1, d1sy6a2, d1sy6h1, d1sy6h2, d1sy6l1
   MQ P04940 P01837 # natural chimera

Details for d1sy6l2

PDB Entry: 1sy6, 2.1 Å

PDB Description: crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment

PDB Compounds: (L:) OKT3 Fab light chain

SCOP Domain Sequences for d1sy6l2:

Sequence; same for both SEQRES and ATOM records:

>d1sy6l2 b.1.1.2 (L:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radtaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1sy6l2:

• d1sy6l2 first appeared in SCOP 1.69
  
• d1sy6l2 appears in SCOP 1.71
  
• d1sy6l2 appears in SCOP 1.75
  
• d1sy6l2 appears in the current release, SCOPe 2.08