Lineage for d1sy6a2 (1sy6 A:118-203)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454669Protein CD3 epsilon chain ectodomain fragment [69162] (2 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454670Species Human (Homo sapiens) [TaxId:9606] [110051] (1 PDB entry)
  8. 454671Domain d1sy6a2: 1sy6 A:118-203 [106112]
    Other proteins in same PDB: d1sy6a1, d1sy6h1, d1sy6h2, d1sy6l1, d1sy6l2

Details for d1sy6a2

PDB Entry: 1sy6 (more details), 2.1 Å

PDB Description: crystal structure of cd3gammaepsilon heterodimer in complex with okt3 fab fragment
PDB Compounds: (A:)

SCOP Domain Sequences for d1sy6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy6a2 b.1.1.4 (A:118-203) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens)}
qtpykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleq
sgyyvcyprgskpedanfylylrarv

SCOP Domain Coordinates for d1sy6a2:

Click to download the PDB-style file with coordinates for d1sy6a2.
(The format of our PDB-style files is described here.)

Timeline for d1sy6a2: