![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (36 proteins) |
![]() | Protein CD3 gamma chain ectodomain fragment [69160] (2 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110050] (1 PDB entry) |
![]() | Domain d1sy6a1: 1sy6 A:1-81 [106111] Other proteins in same PDB: d1sy6a2, d1sy6h1, d1sy6h2, d1sy6l1, d1sy6l2 MQ P09693 P07766 # artificial chimera |
PDB Entry: 1sy6 (more details), 2.1 Å
SCOP Domain Sequences for d1sy6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} qsikgnhlvkvydyqedgsvlltcdaeaknitwfkdgkmigfltedkkkwnlgsnakdpr gmyqckgsqnkskplqvyyrm
Timeline for d1sy6a1:
![]() Domains from other chains: (mouse over for more information) d1sy6h1, d1sy6h2, d1sy6l1, d1sy6l2 |