Lineage for d1sxra1 (1sxr A:11-177)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212615Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2212616Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2212617Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2212669Protein Peptidoglycan-recognition protein-SA (Cg11709) [111139] (1 species)
  7. 2212670Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [111140] (2 PDB entries)
    Uniprot Q9VYX7 37-203 ! Uniprot Q9VYX7
  8. 2212671Domain d1sxra1: 1sxr A:11-177 [106101]
    Other proteins in same PDB: d1sxra2, d1sxrb2
    complexed with edo, so4

Details for d1sxra1

PDB Entry: 1sxr (more details), 1.56 Å

PDB Description: Drosophila Peptidoglycan Recognition Protein (PGRP)-SA
PDB Compounds: (A:) Peptidoglycan recognition protein SA CG11709-PA

SCOPe Domain Sequences for d1sxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxra1 d.118.1.1 (A:11-177) Peptidoglycan-recognition protein-SA (Cg11709) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnp

SCOPe Domain Coordinates for d1sxra1:

Click to download the PDB-style file with coordinates for d1sxra1.
(The format of our PDB-style files is described here.)

Timeline for d1sxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sxra2