SCOPe 2.06: Domain d1svsa1: 1svs A:32-60,A:182-347

Lineage for d1svsa1 (1svs A:32-60,A:182-347)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
   Uniprot P10824

8. Domain d1svsa1: 1svs A:32-60,A:182-347 [106051]
   complexed with gnp, mg; mutant

Details for d1svsa1

PDB Entry: 1svs, 1.5 Å

PDB Description: structure of the k180p mutant of gi alpha subunit bound to gppnhp.

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1svsa1:

Sequence; same for both SEQRES and ATOM records:

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknn

Timeline for d1svsa1:

• d1svsa1 first appeared in SCOP 1.69
  
• d1svsa1 appears in SCOPe 2.05
  
• d1svsa1 appears in SCOPe 2.07
  
• d1svsa1 appears in the current release, SCOPe 2.08