Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.1: Pointed domain [47770] (7 proteins) |
Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry) Uniprot Q9I7G2 94-173 |
Domain d1sv0d1: 1sv0 D:95-173 [106038] Other proteins in same PDB: d1sv0a1, d1sv0a2, d1sv0b1, d1sv0b2, d1sv0c2, d1sv0d2 |
PDB Entry: 1sv0 (more details), 2.07 Å
SCOPe Domain Sequences for d1sv0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv0d1 a.60.1.1 (D:95-173) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} lgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcrv pvggkmlyrdfrvrlaram
Timeline for d1sv0d1: