Lineage for d1sulb_ (1sul B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582125Protein Probable GTPase EngB [89667] (2 species)
  7. 582126Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)
  8. 582129Domain d1sulb_: 1sul B: [106024]

Details for d1sulb_

PDB Entry: 1sul (more details), 2 Å

PDB Description: crystal structure of the apo-ysxc

SCOP Domain Sequences for d1sulb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sulb_ c.37.1.8 (B:) Probable GTPase EngB {Bacillus subtilis}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

SCOP Domain Coordinates for d1sulb_:

Click to download the PDB-style file with coordinates for d1sulb_.
(The format of our PDB-style files is described here.)

Timeline for d1sulb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sula_