SCOP 1.71: Domain d1sulb_: 1sul B:

Lineage for d1sulb_ (1sul B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Probable GTPase EngB [89667] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)

8. Domain d1sulb_: 1sul B: [106024]

Details for d1sulb_

PDB Entry: 1sul, 2 Å

PDB Description: crystal structure of the apo-ysxc

SCOP Domain Sequences for d1sulb_:

Sequence; same for both SEQRES and ATOM records:

>d1sulb_ c.37.1.8 (B:) Probable GTPase EngB {Bacillus subtilis}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

Timeline for d1sulb_:

• d1sulb_ first appeared in SCOP 1.69
  
• d1sulb_ appears in SCOP 1.73
  
• d1sulb_ appears in the current release, SCOPe 2.08