Lineage for d1sula_ (1sul A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867328Protein Probable GTPase EngB [89667] (2 species)
  7. 2867329Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)
    Uniprot P38424
  8. 2867331Domain d1sula_: 1sul A: [106023]

Details for d1sula_

PDB Entry: 1sul (more details), 2 Å

PDB Description: crystal structure of the apo-ysxc
PDB Compounds: (A:) GTP-binding protein YsxC

SCOPe Domain Sequences for d1sula_:

Sequence, based on SEQRES records: (download)

>d1sula_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

Sequence, based on observed residues (ATOM records): (download)

>d1sula_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlaqtlnfyiind
elhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhapsnddvqmyef
lkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdeawgai
kkminr

SCOPe Domain Coordinates for d1sula_:

Click to download the PDB-style file with coordinates for d1sula_.
(The format of our PDB-style files is described here.)

Timeline for d1sula_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sulb_