SCOP 1.69: Domain d1ssfa2: 1ssf A:61-129

Lineage for d1ssfa2 (1ssf A:61-129)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families)

5. Family b.34.9.1: Tudor domain [63749] (2 proteins)
   Pfam 00567

6. Protein p53-binding protein 1, 53BP1 [110163] (1 species)
   duplication; contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [110164] (1 PDB entry)

8. Domain d1ssfa2: 1ssf A:61-129 [105983]

Details for d1ssfa2

PDB Entry: 1ssf

PDB Description: solution structure of the mouse 53bp1 fragment (residues 1463-1617)

SCOP Domain Sequences for d1ssfa2:

Sequence; same for both SEQRES and ATOM records:

>d1ssfa2 b.34.9.1 (A:61-129) p53-binding protein 1, 53BP1 {Human (Homo sapiens)}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglgpye

Timeline for d1ssfa2:

• d1ssfa2 is new in SCOP 1.69
  
• d1ssfa2 appears in SCOP 1.71
  
• d1ssfa2 appears in the current release, SCOPe 2.08