SCOP 1.69: Domain d1sr9b3: 1sr9 B:492-643

Lineage for d1sr9b3 (1sr9 B:492-643)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.270: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110920] (1 superfamily)
   duplication: consists of two beta(3)-alpha repeats; 3 layers, beta/alpha/beta

4. Superfamily d.270.1: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110921] (1 family)

5. Family d.270.1.1: 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110922] (1 protein)

6. Protein 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain [110923] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110924] (1 PDB entry)

8. Domain d1sr9b3: 1sr9 B:492-643 [105965]
   Other proteins in same PDB: d1sr9a1, d1sr9a2, d1sr9b1, d1sr9b2

Details for d1sr9b3

PDB Entry: 1sr9, 2 Å

PDB Description: crystal structure of leua from mycobacterium tuberculosis

SCOP Domain Sequences for d1sr9b3:

Sequence, based on SEQRES records:

>d1sr9b3 d.270.1.1 (B:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis}
vrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvhaladvgfdvav
ldyyehamsagddaqaaayveasvtiaspaqpgeagrhasdpvtiaspaqpgeagrhasd
pvtsktvwgvgiapsittaslravvsavnraa

Sequence, based on observed residues (ATOM records):

>d1sr9b3 d.270.1.1 (B:492-643) 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain {Mycobacterium tuberculosis}
vrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvhaladvgfdvav
ldyyehamsagddaqaaayveasvtiastsktvwgvgiapsittaslravvsavnraa

Timeline for d1sr9b3:

• d1sr9b3 is new in SCOP 1.69
  
• d1sr9b3 appears in SCOP 1.71
  
• d1sr9b3 appears in the current release, SCOPe 2.08