SCOP 1.73: Domain d1sr6a1: 1sr6 A:29-76

Lineage for d1sr6a1 (1sr6 A:29-76)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)

8. Domain d1sr6a1: 1sr6 A:29-76 [105953]
   Other proteins in same PDB: d1sr6a2, d1sr6b_, d1sr6c_
   complexed with ca, mg, so4

Details for d1sr6a1

PDB Entry: 1sr6, 2.75 Å

PDB Description: Structure of nucleotide-free scallop myosin S1

PDB Compounds: (A:) myosin heavy chain, striated muscle

SCOP Domain Sequences for d1sr6a1:

Sequence; same for both SEQRES and ATOM records:

>d1sr6a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

Timeline for d1sr6a1:

• d1sr6a1 first appeared in SCOP 1.69
  
• d1sr6a1 appears in SCOP 1.71
  
• d1sr6a1 appears in SCOP 1.75
  
• d1sr6a1 appears in the current release, SCOPe 2.08