Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries) |
Domain d1sr6a1: 1sr6 A:29-76 [105953] Other proteins in same PDB: d1sr6a2, d1sr6b_, d1sr6c_ complexed with ca, mg, so4 |
PDB Entry: 1sr6 (more details), 2.75 Å
SCOP Domain Sequences for d1sr6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sr6a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
Timeline for d1sr6a1: