| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) ![]() automatically mapped to Pfam PF08997 |
| Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins) |
| Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species) the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located |
| Species Cow (Bos taurus) [TaxId:9913] [81515] (12 PDB entries) Uniprot P07552 |
| Domain d1sqbk_: 1sqb K: [105905] Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_ complexed with azo, fes, hem |
PDB Entry: 1sqb (more details), 2.69 Å
SCOPe Domain Sequences for d1sqbk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqbk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
ltrflgpryrqlarnwvptaqlwgavgavglvwatdsrlildwvpyingkfk
Timeline for d1sqbk_: