Lineage for d1sqbh_ (1sqb H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633065Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2633066Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2633067Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2633068Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 2633083Species Cow (Bos taurus) [TaxId:9913] [81526] (14 PDB entries)
    Uniprot P00126
  8. 2633092Domain d1sqbh_: 1sqb H: [105902]
    Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbi_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqbh_

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOPe Domain Coordinates for d1sqbh_:

Click to download the PDB-style file with coordinates for d1sqbh_.
(The format of our PDB-style files is described here.)

Timeline for d1sqbh_: