![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81526] (12 PDB entries) |
![]() | Domain d1sqbh_: 1sqb H: [105902] Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbi_, d1sqbj_, d1sqbk_ |
PDB Entry: 1sqb (more details), 2.69 Å
SCOP Domain Sequences for d1sqbh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqbh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)} elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah klfnslk
Timeline for d1sqbh_: