Lineage for d1sqbg_ (1sqb G:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887523Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 887524Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 887525Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 887541Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
    Uniprot P13271 #SP
    Uniprot P13271
    Uniprot P13271 #SP ! Uniprot P13271
  8. 887555Domain d1sqbg_: 1sqb G: [105901]
    Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqbg_

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOP Domain Sequences for d1sqbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1sqbg_:

Click to download the PDB-style file with coordinates for d1sqbg_.
(The format of our PDB-style files is described here.)

Timeline for d1sqbg_: