SCOP 1.69: Domain d1sqbg_: 1sqb G:

Lineage for d1sqbg_ (1sqb G:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (12 PDB entries)

8. Domain d1sqbg_: 1sqb G: [105901]
   Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_

Details for d1sqbg_

PDB Entry: 1sqb, 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

SCOP Domain Sequences for d1sqbg_:

Sequence; same for both SEQRES and ATOM records:

>d1sqbg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

Timeline for d1sqbg_:

• d1sqbg_ is new in SCOP 1.69
  
• d1sqbg_ appears in SCOP 1.71
  
• d1sqbg_ appears in the current release, SCOPe 2.08