SCOPe 2.03: Domain d1sqbe1: 1sqb E:70-196

Lineage for d1sqbe1 (1sqb E:70-196)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50025] (18 PDB entries)

8. Domain d1sqbe1: 1sqb E:70-196 [105898]
   Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
   complexed with azo, fes, hem

Details for d1sqbe1

PDB Entry: 1sqb, 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1sqbe1:

Sequence; same for both SEQRES and ATOM records:

>d1sqbe1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

Timeline for d1sqbe1:

• d1sqbe1 first appeared in SCOP 1.69
  
• d1sqbe1 appears in SCOPe 2.02
  
• d1sqbe1 appears in SCOPe 2.04
  
• d1sqbe1 appears in the current release, SCOPe 2.08