SCOP 1.69: Domain d1sqbe1: 1sqb E:70-196

Lineage for d1sqbe1 (1sqb E:70-196)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (2 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [50026] (6 PDB entries)
Domain d1sqbe1: 1sqb E:70-196 [105898]
Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_

Details for d1sqbe1

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

SCOP Domain Sequences for d1sqbe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbe1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1sqbe1:

Click to download the PDB-style file with coordinates for d1sqbe1.
(The format of our PDB-style files is described here.)

Timeline for d1sqbe1: