SCOP 1.71: Domain d1sqbd2: 1sqb D:196-241

Lineage for d1sqbd2 (1sqb D:196-241)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (12 PDB entries)

8. Domain d1sqbd2: 1sqb D:196-241 [105897]
   Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
   complexed with azo, fes, hem

Details for d1sqbd2

PDB Entry: 1sqb, 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

SCOP Domain Sequences for d1sqbd2:

Sequence; same for both SEQRES and ATOM records:

>d1sqbd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d1sqbd2:

• d1sqbd2 first appeared in SCOP 1.69
  
• d1sqbd2 appears in SCOP 1.73
  
• d1sqbd2 appears in the current release, SCOPe 2.08