Lineage for d1sqbd1 (1sqb D:1-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304893Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2304894Protein Cytochrome bc1 domain [46677] (4 species)
  7. 2304910Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
    Uniprot P00125
  8. 2304923Domain d1sqbd1: 1sqb D:1-195 [105896]
    Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
    complexed with azo, fes, hem

Details for d1sqbd1

PDB Entry: 1sqb (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqbd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1sqbd1:

Click to download the PDB-style file with coordinates for d1sqbd1.
(The format of our PDB-style files is described here.)

Timeline for d1sqbd1: